hCELA3A, GFP/His-Tag

€820.00

Price excl. shipping costs excl. VAT. For more information, see our shipping policy

SKU: P2020-108 trenzyme

Need a quote for an individual request or for a bulk order?

Please contact us.

Description

The elastase 3A is relative to pancreatic serine proteinases and has a low level of elastolytic activity comparing to other elastases. Elastase 3A is probably involved in the intestinal transport and metabolism of cholesterol. Furthermore, elastase 3A is an efficient protease that preferentially cleaves proteins after alanine residues due to its alanine specificity. Both elastase 3A and elastase 3B have been referred to as protease E and elastase 1.

Overview

  • Product Name: hCELA3A, GFP/His-Tag
  • Catalog No.: P2020-108
  • RefSeq Links: UniProt: P09093
  • Synonyms: Chymotrypsin-like elastase family member 3A; Elastase IIIA; Elastase-3A; ELA3; ELA3A; Protease E; OTTHUMP00000002835; elastase 3A; pancreatic
Cellebrity Kolben Cell Cartoon trenzyme

Customer Testimonial

“We highly valued the fast and excellent communication and the high flexibility of the team! For any future project, we will preferably entrust in trenzyme’s protein production services.”


Dr. Thore Hettmann
Probiodrug AG, Halle/Saale, Germany

Sequence Information

  • Species: Homo sapiens, human
  • Tags: GFP/His-Tag, C-terminal
  • Sequence without tags (AA 18-270):
    YGPPSSHSSSR_VVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISR
    DLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGD
    AVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGST
    VKKTMVCAGGYIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNFIWKPTVFTRVS
    AFIDWIEETIASHV

Product Information

  • Expression Host: human, HEK293
  • Formulation: PBS, pH  7,4
  • Format: Liquid, stored and shipped at -80°C
  • Purity: > 95% as determined by SDS-PAGE

Background Information

Chymotrypsin-like elastases (CELAs) are pancreatic serine proteinases, which belong to the peptidase S1 family, a subfamily of serine proteases. The human CELA3A is a member of the elastase family, which consists of six human elastase genes encoding the proteins elastase 1, 2, 2A, 2B, 3A, and 3B, all of which are structurally similar. Typically, elastases hydrolyze many proteins in addition to elastin. However, CELA3A has only little elastolytic activity. CELA3A is secreted by the pancreas and characterized by a digestive function in the intestine, very similar to other serine proteases such as trypsin, chymotrypsin and kallikrein. The protein contains GFP as fusion partner at the C-terminal end.


SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-PAGE of hACE2-non-biotinylated
Histogram (of marked lane in gel picture) hACE2-non-biotinylated

Get in contact with us


By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.