SARS-CoV-2 M Protein, GFP/His-tagged

€780.00

Price excl. shipping costs excl. VAT. For more information, see our shipping policy

SKU: P2020-020 trenzyme

Need a quote for an individual request or for a bulk order?

Please contact us.

Description

The M or matrix protein is the most abundant protein in the virus and is usually located at the inner layer of the virus envelope. The M protein defines the shape of the virus and contacts the N protein for additional stability.

Overview

  • Product Name: SARS-CoV-2 M Protein, GFP/His-tagged
  • Catalog No.: P2020-020
  • RefSeq Links: UniProt: P0DTC5
  • Synonyms: SARS-CoV-2; coronavirus; SARS-CoV-2 M; M protein; Membrane glycoprotein; 2019-nCoV; COVID-2019; COVID-19

Sequence Information

  • Species: SARS-CoV-2; Wuhan seafood market pneumonia virus
  • Tags: His-Tag, C-terminal
  • Sequence without tags:
    MADSNGTITVEELKKLLEQWNLVIGFLFLTWICLLQFAYANRNRFLYIIKLIFLWLLWPVTLACFVLAAVYRI
    NWITGGIAIAMACLVGLMWLSYFIASFRLFARTRSMWSFNPETNILLNVPLHGTILTRPLLESELVIGAVILR
    GHLRIAGHHLGRCDIKDLPKEITVATSRTLSYYKLGASQRVAGDSGFAAYSRYRIGNYKLNTDHSSSSDNIA
    LLVQ

Product Information

  • Expression Host: human, HEK293-F (FreeStyle cells)
  • Formulation: 20mM Tris, pH 7.5, 300mM NaCl, 0.05% DDM, 0.5% CHS
  • Format: Liquid, stored and shipped at -80°C
  • Purity: > 85% as determined by SDS-PAGE

Background Information

One of the most abundant proteins in the severe acute respiratory syndrome corona virus (SARS-CoV) is the matrix (M) protein. It is usually located at the inner layer of the viral envelope membrane and defines the shape of the virus together with the capsid. It establishes the contact between the nucleoprotein (N protein), the envelope protein (E protein) and the viral envelope for additional stability of the virus. Because of its high abundancy in the viral particle, it poses an attractive target for the development of vaccines and drugs against SARS-CoV-2.​


SDS-PAGE analysis

Size exclusion chromotography chromatogram

SDS-PAGE of M Protein Size exclusion chromatography chromatogram of M Protein

Get in contact with us


By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.