SARS-CoV-2 S1 (RBD) Cluster 5 (Denmark), GFP/His-Tag
€470.00
Price excl. shipping costs excl. VAT. For more information, see our shipping policy
SKU: P2020-039 trenzyme
Description
Recombinant protein of the receptor binding domain (RBD), Mutant (Y453F) of SARS-CoV-2 (COVID-2019) Spike S1 from Wuhan pneumonia virus with C-terminal His/GFP-Tag. The Y453F mutation (also called Danish Mink mutation / Cluster 5 mutation (ΔFVI-spike)) was first discovered in Denmark and is located in a conservative region of the RBD directly involved in ACE2 binding. Thereby, this mutation could have implications for viral fitness, transmissibility and antigenicity.
Overview
-
Product Name: SARS-CoV-2 S1 (RBD) (Y453F), GFP/His-Tag
- Catalog No.: P2020-039
- RefSeq Links: NC_045512.2; MN908947.3; YP_009724390.1; QHD43416.1; GeneID: 43740568; UniProt: P0DTC2
-
Synonyms: SARS-CoV-2; coronavirus; SARS-CoV-2 spike RBD; SARS-CoV-2 spike protein; 2019-nCoV; COVID-2019; COVID-19; RBD (Y453F); Danish Mink mutation; Cluster 5 Mutation; ΔFVI spike
Customer Testimonial
“In our COVID-19 projects, we have had very good experience with the SARS-CoV-2 proteins produced by trenzyme: rapid and reliable production of the functional proteins from different cell lines continued to provide first-class support for our projects.”
Dr. Peter Rauch
CANDOR Bioscience GmbH, Wangen, Germany
Sequence Information
-
Species: SARS-CoV-2; Wuhan seafood market pneumonia virus
- Tags: GFP/His-Tag, C-terminal
-
Sequence without tags (AA 319-541):
MRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTF
KCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWN
SNNLDSKVGGNYNYLFRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGF
QPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
X indicates mutation sites
Product Information
- Expression Host: human, HEK293
- Formulation: PBS, pH 7,4
- Format: Liquid, stored and shipped at -80 °C
- Purity: > 85% as determined by SDS-PAGE
Background Information
The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The target protein is also a major immunogen and a possible target for entry inhibitors.
The SARS-CoV-2 spike (S) protein is a large type I transmembrane protein composed of two subunits, S1 and S2. The S1 subunit contains a receptor-binding domain (RBD) responsible for binding to the host cell receptor angiotensin-converting enzyme 2 (ACE2). Several mutants of the spike protein are known. A mutation first discovered in Denmark, called “Cluster 5”, also known as the ΔFVI-spike, is related to four genetic changes. This mutation (Y453F) is located in a conservative region of the RBD directly involved in ACE2 binding and thereby could have implications for viral fitness, transmissibility, and antigenicity.
|
SDS-PAGE/Coll. Coomassie |
Histogram of marked lane in gel picture |
 |
 |
