
SARS-CoV-2 (COVID-19) Spike S1 Protein (RBD), liquid formulation
€300.00
Price excl. shipping costs excl. VAT. For more information, see our shipping policy
SKU: P2020-001 trenzyme
Description
Recombinant protein of the receptor binding domain (RBD) of SARS-CoV-2 (COVID-19) Spike S1 from Wuhan pneumonia virus with C-terminal His-Tag, liquid formulation.
Overview
- Product Name: SARS-CoV-2 (COVID-19) Spike S1 Protein (RBD), liquid formulation
- Catalog No.: P2020-001
- RefSeq Links: NC_045512.2; MN908947.3; YP_009724390.1; QHD43416.1; GeneID: 43740568; UniProt: P0DTC2
- Synonyms: SARS-CoV-2; coronavirus; SARS-CoV-2 spike RBD; SARS-CoV-2 spike protein; 2019-nCoV; COVID-2019; COVID-19

Customer Testimonial

“In our COVID-19 projects, we have had very good experience with the SARS-CoV-2 proteins produced by trenzyme: rapid and reliable production of the functional proteins from different cell lines continued to provide first-class support for our projects.”
Dr. Peter Rauch
CANDOR Bioscience GmbH, Wangen, Germany
Sequence Information
- Species: SARS-CoV-2; Wuhan seafood market pneumonia virus
- Tags: His-Tag, C-terminal
-
Sequence without tags (AA 319-541):
MRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTF
KCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWN
SNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGF
QPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
Product Information
- Expression Host: human, HEK293
- Formulation: PBS, pH 7,4
- Format: Liquid, stored and shipped at -80 °C
- Purity: > 85% as determined by SDS-PAGE
Background Information
The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The severe acute respiratory syndrome-coronavirus (SARS-CoV) spike (S) glycoprotein is responsible for membrane fusion and is therefore required for virus entry and cell fusion. The target protein is also a major immunogen and a possible target for entry inhibitors.
The SARS-CoV-2 spike (S) protein is a large type I transmembrane protein composed of two subunits, S1 and S2. The S1 subunit contains a receptor-binding domain (RBD) responsible for binding to the host cell receptor angiotensin-converting enzyme 2 (ACE2). The S2 subunit mediates fusion between the viral and host cell membranes. The S1 RBD protein plays key parts in the induction of neutralizing-antibody and T-cell responses, as well as protective immunity.
SARS-CoV-2 Spike S1 (RBD) recognizes hACE2 (ECD) with an affinity constant of 1 nM as verified by biolayer interferometry |
SARS-CoV-2 Spike S1 (RBD) is highly pure and forms stable monomers of 28 kDa as verified by SEC |
![]() |
![]() |
Biolayer interferometry binding analysis (green lines) of hACE2 (ECD, processed), Tag-free to immobilized SARS-CoV-2 Spike S1 (RBD), His-Tag on Ni-NTA Dip and Read™ Biosensors. Grey lines correspond to a global fit of the data using a 1:1 binding model. |
Size exclusion chromatography (SEC) of purified SARS-CoV-2 Spike S1 (RBD), His-Tag protein, determination of elution profile by absorbance at 280 nm (blue line).
|
Fluorescence chromatogram |
Activity of SARS-CoV-2 S1(RBD) |
![]() |
![]() |
Analysis of released N-glycans by HILIC (example data). More and lot specific analytical data available on request (provided by our partner Biofidus AG). |
Activity of different SARS-CoV-2 S1(RBD) lots was determined using a Sandwich-ELISA with antibodies from Sino Biological Europe GmbH (coat: #40150-D003 and detection: #40150-D001-H). |
Stability during storage at 4°C |
|
![]() |
|
Stability during storage at 4°C determined by functional ELISA (binding to hACE2 (ECD) – Cat# P2020-016; detection by mAb CR3022). |
|
SDS-PAGE/Coll. Coomassie |
Histogram of marked lane in gel picture |
![]() |
![]() |
Citations
1 Ultra-sensitive and fast optical detection of the spike protein of the SARS-CoV-2 using AgNPs/SiNWs nanohybrid based sensors
2 Persistence of functional memory B cells recognizing SARS-CoV-2 variants despite loss of specific IgG
- Memory B cells persist in blood of COVID-19 patients despite loss of specific Ig
- Differentiating B cells in vitro robustly reveals previous SARS-CoV-2 infection
- Ig derived from memory B cells neutralizes SARS-CoV-2 variants
- Persisting memory B cells contribute to protective immunity against SARS-CoV-2
3 Continuous population-level monitoring of SARS-CoV-2 seroprevalence in a large European metropolitan region
-
We continuously assessed SARS-CoV-2 seroprevalence in two cohorts (n = 72′250)
-
Modeled cumulative incidence was 3 × higher than suggested by PCR-based testing
-
On the population level, antibody half-life was 75 days
-
10% of individuals maintained symptoms one year post–COVID-19