B7-H3 Protein, Mouse

€1,190.00

Price excl. shipping costs excl. VAT. For more information, see our shipping policy

SKU: P2020-003 trenzyme

Need a quote for an individual request or for a bulk order?

Please contact us.

Description

Recombinant protein containing the extracellular domain (ECD) of mouse CD276 with C-terminal His-Tag.

Overview

  • Product Name: B7-H3 Protein, Mouse
  • Catalog No.: P2020-003
  • RefSeq Links: UniProt: Q8VE98
  • Synonyms: B7 homolog 3; B7-H3 Protein, Mouse; B7H3 Protein, Mouse; B7RP-2 Protein; CD276
Cellebrity Kolben Cell Cartoon trenzyme

Sequence Information

  • Species: Mus musculus, mouse
  • Tags: His-Tag, C-terminal
  • Sequence without tags (AA 29-245):
    MVEVQVSEDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYSNRTALFPDLLVQGNAS
    LRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGNMVTITCSSYQGYPEAEVFWKDGQG
    VPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPLTFP

Product Information

  • Expression Host: human, HEK293
  • Formulation: PBS, pH 7,4
  • Format: Liquid, stored and shipped at -80°C
  • Purity: > 95% as determined by SDS-PAGE

Background Information

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-PAGE/Coll. Coomassie
Histogram of marked lane in gel picture

Get in contact with us


By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.