SARS-CoV-2 S1 (RBD) Gamma, P.1 (Brazil), GFP/His-Tag

€420.00 €470.00

Price excl. shipping costs excl. VAT. For more information, see our shipping policy

SKU: P2020-043 trenzyme

Need a quote for an individual request or for a bulk order?

Please contact us.

Description

Recombinant protein of the receptor binding domain (RBD), Mutant (K417T-E484K-N501Y) of SARS-CoV-2 (COVID-19) Spike S1 from Wuhan pneumonia virus with C-terminal His/GFP-Tag. The mutations K417T-E484K-N501Y are characteristic for the fast spreading SARS-CoV-2 virus Gamma variant (P.1 lineage) emerged in Brazil. These mutations are affecting the receptor binding domain (RBD) of the spike protein, which the virus uses to bind to human cells receptors and enter them. Due to the mutations, the virus is allowed to bind with higher affinity to human ACE2 receptor, which results in approximately 160% increased transmissibility of the SARS-CoV-2 virus Gamma variant.

Overview

  • Product Name: SARS-CoV-2 S1 (RBD) (K417T, E484K, N501Y), GFP/His-Tag
  • Catalog No.: P2020-043
  • RefSeq Links: NC_045512.2; MN908947.3; YP_009724390.1; QHD43416.1; GeneID: 43740568; UniProt: P0DTC2
  • Synonyms: SARS-CoV-2; coronavirus; SARS-CoV-2 spike RBD; SARS-CoV-2 spike protein; 2019-nCoV; COVID-2019; COVID-19; RBD (N501Y); 501.V2; VUI-202012/01; B.1.1.7; B117; U.K. Variant; U.K. lineage; B.1.351; B1351; South Africa Variant; South African lineage; P.1; P1, Brazil Variant; Brazilian lineage; N501Y mutation of SARS-CoV-2 Spike
Cellebrity Kolben Cell Cartoon trenzyme

Customer Testimonial

“In our COVID-19 projects, we have had very good experience with the SARS-CoV-2 proteins produced by trenzyme: rapid and reliable production of the functional proteins from different cell lines continued to provide first-class support for our projects.”


Dr. Peter Rauch
CANDOR Bioscience GmbH, Wangen, Germany

Sequence Information

  • Species: SARS-CoV-2; Wuhan seafood market pneumonia virus
  • Tags: GFP/His-Tag, C-terminal
  • Sequence without tags (AA 319-541):

    MRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTF
    KCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGTIADYNYKLPDDFTGCVIAWN
    SNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVKGFNCYFPLQSYGF
    QPTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF

    X indicates mutation sites

Product Information

  • Expression Host: human, HEK293
  • Formulation: PBS, pH  7,4
  • Format: Liquid, stored and shipped at -80 °C
  • Purity: > 85% as determined by SDS-PAGE

Background Information

The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The target protein is also a major immunogen and a possible target for entry inhibitors.
The SARS-CoV-2 spike (S) protein is a large type I transmembrane protein composed of two subunits, S1 and S2. The S1 subunit contains a receptor-binding domain (RBD) responsible for binding to the host cell receptor angiotensin-converting enzyme 2 (ACE2). Several mutants of the spike protein are known. A new SARS-CoV-2 lineage called 20J/501Y.V3, also known as Gamma variant or P.1 lineage, exhibits several mutations. Compared to the previously circulating variants, the mutation E484K and K417T of SARS-CoV-2 Spike S1 (RBD) Gamma variant may affect neutralization by some polyclonal and monoclonal antibodies. Furthermore, the mutation N501Y may influence the binding affinity of the spike protein to hACE2. Therefore, the Gamma variant is considered as one of the most dangerous modification of the virus, resulting in a 160% higher transmissibility.

 

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-PAGE of SARS-CoV-2 S1 RBD Mutant K417T, E484K, N501Y, GFP/His-Tag
Histogram (of marked lane in gel picture) of SARS-CoV-2 S1 RBD Mutant K417T, E484K, N501Y, GFP/His-Tag

Get in contact with us


By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.