SARS-CoV-2 S1 (RBD) Lambda C.37 (Peru), GFP/His-Tag

€420.00 €470.00

Price excl. shipping costs excl. VAT. For more information, see our shipping policy

SKU: P2020-054 trenzyme

Need a quote for an individual request or for a bulk order?

Please contact us.

Description

Recombinant protein of the receptor binding domain (RBD), Mutant (L452Q-F490S) of SARS-CoV-2 (COVID-2019) Spike S1 from Wuhan pneumonia virus with C-terminal His/GFP-Tag. The mutations L452Q-F490S are characteristic for the SARS-CoV-2 virus variant C.37 emerged in South America (Peru) in late 2020. C.37 is classified as Variant of Interest (VOI) and also known as Lambda variant. The mutations are affecting the receptor binding domain (RBD) of the spike protein, which the virus uses to bind to human cells receptors and enter them. The variant may result in an increased transmissibility and viral fitness. The F490S mutation together with other mutations at position L452, has been associated with resistance to neutralization.

Overview

  • Product Name: SARS-CoV-2 S1 (RBD) (L452Q, F490S), GFP/His-Tag (cleavable)
  • Catalog No.: P2020-054
  • RefSeq Links: NC_045512.2; MN908947.3; YP_009724390.1; QHD43416.1; GeneID: 43740568; UniProt: P0DTC2
  • Synonyms: SARS-CoV-2; coronavirus; SARS-CoV-2 spike RBD; SARS-CoV-2 spike protein; 2019-nCoV; COVID-2019; COVID-19; RBD (L452Q, F490S); GR/452Q.V1; 21G; Lambda; C.37; B.1.1.1.37; South America Variant; Peru; F490S; L452Q
Cellebrity Kolben Cell Cartoon trenzyme

Customer Testimonial

“In our COVID-19 projects, we have had very good experience with the SARS-CoV-2 proteins produced by trenzyme: rapid and reliable production of the functional proteins from different cell lines continued to provide first-class support for our projects.”


Dr. Peter Rauch
CANDOR Bioscience GmbH, Wangen, Germany

Sequence Information

  • Species: SARS-CoV-2; Wuhan seafood market pneumonia virus
  • Tags: GFP/His-Tag, C-terminal
  • Sequence without tags (AA 319-541):

    MRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTF
    KCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWN
    SNNLDSKVGGNYNYQYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYSPLQSYGF
    QPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF

    X indicates mutation sites

Product Information

  • Expression Host: human, HEK293
  • Formulation: PBS, pH  7,4
  • Format: Liquid, stored and shipped at -80°C
  • Purity: > 95% as determined by SDS-PAGE

Background Information

The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The target protein is also a major immunogen and a possible target for entry inhibitors.
The SARS-CoV-2 spike (S) protein is a large type I transmembrane protein composed of two subunits, S1 and S2. The S1 subunit contains a receptor-binding domain (RBD) responsible for binding to the host cell receptor angiotensin-converting enzyme 2 (ACE2). Several mutants of the spike protein are known. A new SARS-CoV-2 lineage called C.37 or Lambda variant, exhibits 7 mutations in the spike protein. Compared to the other circulating variants, the mutations L452Q and F490S of the SARS-CoV-2 Spike S1 (RBD) are known to make the virus more resistant to neutralizing antibodies and therefore may also have an influence on the effectiveness of existing vaccines. The Lambda variant is classified by the World Health Organization (WHO) as Variant of Interest (VOI).


SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-PAGE of SARS-CoV-2 S1 RBD Mutant L452Q, F490S, GFP/His-Tag
Histogram (of marked lane in gel picture) of SARS-CoV-2 S1 RBD Mutant L452Q, F490S, GFP/His-Tag



Get in contact with us


By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.