SARS-CoV-2 S1 (RBD) Mu B.1.621 (Columbia), GFP/His-Tag
€470.00
Price excl. shipping costs excl. VAT. For more information, see our shipping policy
SKU: P2020-057 trenzyme
Description
Recombinant protein of the receptor binding domain (RBD), Mutant (R346K, E484K, N501Y) of SARS-CoV-2 (COVID-2019) spike S1 from Wuhan pneumonia virus with C-terminal GFP/His tag. The mutations R346K, E484K, and N501Y are identified in the SARS-CoV-2 virus variant B.1.621, which emerged in South America and was first reported in Colombia in January 2021. B.1.621 classified as Variant of Interest (VOI) and also known as Mu variant. The mutations are located in the RBD domain of SARS-CoV-2 and bind with high affinity to the human ACE2 receptor. The Colombian Mu variant initiates infection in the upper respiratory tract and is considered as the fastest spreading variant and one of the most dangerous.
Overview
-
Product Name: SARS-CoV-2 S1 (RBD) (R346K, E484K, N510Y), GFP/His-Tag (cleavable)
- Catalog No.: P2020-057
- RefSeq Links: NC_045512.2; MN908947.3; YP_009724390.1; QHD43416.1; GeneID: 43740568; UniProt: P0DTC2
-
Synonyms: SARS-CoV-2; coronavirus; SARS-CoV-2 spike RBD; SARS-CoV-2 spike protein; 2019-nCoV; COVID-2019; COVID-19; RBD (R346K, E484K, N510Y); Mu; B.1.621; Columbian Variant; Columbia; R346K; E484K; N510Y
Customer Testimonial
“In our COVID-19 projects, we have had very good experience with the SARS-CoV-2 proteins produced by trenzyme: rapid and reliable production of the functional proteins from different cell lines continued to provide first-class support for our projects.”
Dr. Peter Rauch
CANDOR Bioscience GmbH, Wangen, Germany
Sequence Information
-
Species: SARS-CoV-2; Wuhan seafood market pneumonia virus
- Tags: GFP/His-Tag, C-terminal
-
Sequence without tags (AA 319-541):
MRVQPTESIVRFPNITNLCPFGEVFNATKFASVYAWNRKRISNCVADYSVLYNSASFSTF
KCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWN
SNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVKGFNCYFPLQSYGF
QPTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
X indicates mutation sites
Product Information
- Expression Host: human, HEK293
- Formulation: PBS, pH 7,4
- Format: Liquid, stored and shipped at -80°C
- Purity: > 95% as determined by SDS-PAGE
Background Information
The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The target protein is also a major immunogen and a possible target for entry inhibitors.
The SARS-CoV-2 spike (S) protein is a large type I transmembrane protein composed of two subunits, S1 and S2. The S1 subunit contains a receptor-binding domain (RBD) responsible for binding to the host cell receptor angiotensin-converting enzyme 2 (ACE2). Several mutants of the spike protein are known. There is strong evidence that this particular mutation increases the infectivity of SARS-CoV-2 and the ability of the host to evade the immune system. Of all the amino acid changes in the Colombian Mu variant, the E484K mutation was previously discovered in the Alpha (UK), Beta (South Africa), and Gamma (Brazil) lineages, and is thought to further enhance the ability to evade the immune system. The N501Y mutation site in this variant leads to an enhancement of viral transmission. Early studies showed that this new variant has lower susceptibility to convalescent plasma. In addition, the Mu variant contains the R346K mutation, which has been detected in dominant circulating variants of the virus responsible for COVID-19 disease. The Mu variant is classified as a "variant of interest" (VOI) by the World Health Organization (WHO).
|
SDS-PAGE/Coll. Coomassie |
Histogram of marked lane in gel picture |
 |
 |