Furin, GFP/His-tag
€990.00
Price excl. shipping costs excl. VAT. For more information, see our shipping policy
SKU: P2020-119 trenzyme
Description
Recombinant Furin protease containing a GFP/His-tag produced in mammalian cell system (HEK cells). The protease cleaves proteins just downstream of a basic amino acid target sequence thereby processing cellular precursor proteins and activating toxins like Anthrax or viral proteins like SARS-CoV-2 Spike protein.
Overview
-
Product Name: Furin, GFP/His-Tag
- Catalog No.: P2020-119
- RefSeq Links: UniProt: P09958; NP_001276752.1; NM_001289823.1; NP_001276753.1; NM_001289824.1; NP_002560.1; NM_002569.3; PIR: A39552; GeneID: 5045
- Synonyms: Furin (Paired Basic Amino Acid Cleaving Enzyme); PCSK3; PACE; FUR; SPC1; Paired Basic Amino Acid Residue-Cleaving Enzyme; EC 3.4.21.75; Paired Basic Amino Acid Cleaving Enzyme (Furin, Membrane Associated Receptor Protein); Proprotein Convertase Subtilisin/Kexin; EC 3.4.21
Customer Testimonial
“We highly valued the fast and excellent communication and the high flexibility of the team! For any future project, we will preferably entrust in trenzyme’s protein production services.”
Dr. Thore Hettmann
Probiodrug AG, Halle/Saale, Germany
Sequence Information
- Species: Homo sapiens, human
- Tags: GFP/His-Tag, C-terminal
-
Sequence without tags (AA 27-715):
MQKVFTNTWAVRIPGGPAVANSVARKHGFLNLGQIFGDYYHFWHRGVTKRSLSPHRPRHS
RLQREPQVQWLEQQVAKRRTKRDVYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGH
GIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYTQMNDNRHGTRCAGEVAAV
ANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDG
PARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGN
VPWYSEACSSTLATTYSSGNQNEKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEAN
KNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKVSHSYGYGLLDAGAMVALAQNWTTVA
PQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPNHITRLEHAQARLTLSYNRRGDLAIHL
VSPMGTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPSGEWVLEIENTSEANNYGTLTK
FTLVLYGTAPEGLPVPPESSGCKTLTSSQACVVCEEGFSLHQKSCVQHCPPGFAPQVLDT
HYSTENDVETIRASVCAPCHASCATCQGPALTDCLSCPSHASLDPVEQTCSRQSQSSRES
PPQQQPPRLPPEVEAGQRLRAGLLPSHLPE
Product Information
- Expression Host: human, HEK293
- Formulation: PBS; pH 7.4.
- Format: Liquid, stored and shipped at -80°C
- Purity: > 85% as determined by SDS-PAGE
Background Information
Furin, also known as paired basic Amino acid Cleaving Enzyme (PACE) is a ubiquitous subtilisin-like proprotein convertase with a minimal cleavage site of Arg-X-X-Arg˅. However, the enzyme prefers the site Arg-X-Lys/Arg-Arg˅.
It is the major processing enzyme of the secretory pathway and is localized in the trans-golgi network where it functions to cleave other proteins into their mature/active forms.
Substrates of Furin include blood clotting factors, serum proteins and growth factor receptors such as the insulin-like growth factor receptor but also viral proteins like the SARS-CoV-2 Spike protein.
Furin is inhibited by EGTA, α1- Antitrypsin Portland and polyarginine compounds.
|
SDS-PAGE/Coll. Coomassie |
Histogram of marked lane in gel picture |
 |
 |
