Structural model of hCELA3A, His-Tag

hCELA3A, His-Tag

€790.00

Price excl. shipping costs excl. VAT. For more information, see our shipping policy

SKU: P2020-102 trenzyme

Contact us for a quote

Need a quote for an individual request or for a bulk order?

Please contact us.

Description

The elastase 3A is relative to pancreatic serine proteinases and has a low level of elastolytic activity comparing to other elastases. Elastase 3A is eventually involved in the intestinal transport and metabolism of cholesterol. Elastase 3A and elastase 3B are also referred to as protease E and elastase 1, respectively. Furthermore, elastase 3A is an efficient protease that preferentially cleaves proteins after the alanine residue due to its alanine specificity.

Overview

  • Product Name: hCELA3A, His-Tag
  • Catalog No.: P2020-102
  • RefSeq Links: UniProt: P09093
  • Synonyms: Chymotrypsin-like elastase family member 3A; Elastase IIIA; Elastase-3A; ELA3; ELA3A; Protease E; OTTHUMP00000002835; elastase 3A; pancreatic

Sequence Information

  • Species: Homo sapiens, human
  • Tags: His-Tag, C-terminal
  • Sequence without tags (AA 18-270):
    YGPPSSHSSSR_VVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISR
    DLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGD
    AVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGST
    VKKTMVCAGGYIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNFIWKPTVFTRVS
    AFIDWIEETIASH

Product Information

  • Expression Host: human, HEK293
  • Formulation: PBS, pH  7,4
  • Format: Liquid, stored and shipped at -80°C
  • Purity: > 90% as determined by SDS-PAGE

Background Information

Chymotrypsin-like elastases (CELAs) are pancreatic serine proteinases. This enzyme belongs to the peptidase S1 family which is subfamily of serine proteases. The human CELA3A is a member of the elastase family, which consists of the six human elastase genes. The next proteins elastase 1, 2, 2A, 2B, 3A, and 3B are structurally similar and encoded by elastase genes which are known in human. The human pancreas does not express CELA1 but secretes two CELA3 isoforms, CELA3A and CELA3B as a zymogen and has a digestive function in the intestine, very similar to other serine proteases such as trypsin, chymotrypsin and kallikrein. Peptidase S1 domain is included in the structure of CELA3A and hydrolyzing many proteins in addition to elastin. hCELA3A is the product of gene duplication and shares 92% identity in their primary structure.


SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture
SDS-PAGE of hCELA3A, His-Tag Histogram (of marked lane in gel picture) hCELA3A, His-Tag

Download

Download Product Information for hCELA3A, His-Tag

Get in contact with us


By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.