Lanmodulin (LanM)
€899.00
Price excl. shipping costs excl. VAT. For more information, see our shipping policy
SKU: P2020-126 trenzyme
Description
Lanmodulin (LanM) is a bacterial protein exhibiting metal-binding properties. It binds rare-earth elements (REEs) with very high affinity.
Overview
-
Product Name: LanM
- Catalog No.: P2020-126
- RefSeq Links: UniProt: B1ZIE8; WP_003601797.1; PDB: 6MI5_X
- Synonyms: Lanmodulin; Lanthanides; Lns
Sequence Information
- Species: Methylorubrum extorquens
- Tags: His-Tag, C-terminal
-
Sequence without tags (AA 1-133):
MAFRLSSAVLLAALVAAPAYAAPTTTTKVDIAAFDPDKDGTIDLKEALAAGSAAFDKLDP
DKDGTLDAKELKGRVSEADLKKLDPDNDGTLDKKEYLAAVEAQFKAANPDNDGTIDAREL
ASPAGSALVNLIR
Product Information
- Expression Host: E. coli
- Formulation: PBS; pH 7.4.
- Format: Liquid, stored and shipped at -80°C
- Purity: > 95% as determined by SDS-PAGE
Background Information
Lanthanides (Lns) are essential cofactors in certain enzymes. Lanmodulin (LanM) is a metal binding protein found in several lanthanide-utilizing, methylotrophic bacteria like Methylorubrum sp. The protein exhibits unique metal-binding properties and binds rare-earth elements (REEs) with very high affinity, often better than many synthetic chelators. LanM-REE complexes are stable at extreme conditions like high temperature, repeated acid treatments down to pH 2.5 and up to molar amounts of competing non-REE metal ions.
Therefore, lanmodulin could be used even in harsh chemical processes for selective recovery of a broad range of REE from precumbustion coal and electronic waste leachates.
SDS-PAGE/Coll. Coomassie |
Histogram of marked lane in gel picture |