SARS-CoV-2 (COVID-19) Nucleocapsid protein, His-Tag

€420.00

Price excl. shipping costs excl. VAT. For more information, see our shipping policy

SKU: P2020-010 trenzyme

Need a quote for an individual request or for a bulk order?

Please contact us.

Description

Recombinant SARS-CoV-2 (COVID-2019) Nucleoprotein (N-protein) from Wuhan pneumonia virus with C-terminal His-Tag.

Overview

  • Product Name: SARS-CoV-2 (COVID-19) Nucleocapsid protein, His-Tag
  • Catalog No.: P2020-010
  • RefSeq Links: YP_009724397.2; UniProt: P0DTC9
  • Synonyms: coronavirus NP Protein; 2019-nCoV; coronavirus Nucleocapsid Protein; coronavirus Nucleoprotein Protein; cov np Protein; ncov NP Protein; N Protein; NCP-CoV Nucleocapsid Protein; novel coronavirus NP Protein; novel coronavirus Nucleocapsid Protein; novel coronavirus Nucleoprotein Protein; np Protein; nucleocapsid Protein; Nucleoprotein Protein
Cellebrity Kolben Cell Cartoon trenzyme

Customer Testimonial

“In our COVID-19 projects, we have had very good experience with the SARS-CoV-2 proteins produced by trenzyme: rapid and reliable production of the functional proteins from different cell lines continued to provide first-class support for our projects.”


Dr. Peter Rauch
CANDOR Bioscience GmbH, Wangen, Germany

Sequence Information

  • Species: SARS-CoV-2; Wuhan seafood market pneumonia virus
  • Tags: His-Tag, C-terminal
  • Sequence without tags (AA 1-419):
    MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHG
    KEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAG
    LPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGS
    QASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQ
    QQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKH
    WPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAY
    KTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQAS

Product Information

  • Expression Host: E. coli
  • Formulation: PBS, pH 7,4
  • Format: Liquid, stored and shipped at -80°C
  • Purity: > 85% as determined by SDS-PAGE

Background Information

Beneath its envelope membrane, the new coronavirus SARS-CoV-2 consists of an icosaedric nucleocapsid that contains its genectic information in form of positive sensed single-stranded RNA. The RNA is contained in a nucleoprotein complex, consisting of the SARS-CoV-2 (COVID-19) Nucleocapsid protein. This phosphoprotein is necessary to keep the capsid in its helical symmetry and aids with packaging into the viral capsid by acting as a molecular RNA chaperone. Together with the matrix (M) protein, the N-protein is one of the most abundant proteins in the viral particle, it is important for viral replication and is also known for modulating cellular signalling. It is highly immunogenic and its sequence is very conserved, therefore it is an attractive target for diagnostic purposes.


SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-PAGE of SARS-CoV-2 N-Protein Histogram (of marked lane in gel picture) of N-Protein,Hist-Tag

Citations

1 Quantitative measurement of IgG to SARS-CoV-2 antigens using monoclonal antibody-based enzyme-linked immunosorbent assays

Authors: Ingrid Sander, Sabine Kespohl, Eva Zahradnik, Philipp Göcke, Ingolf Hosbach, Burkhard L Herrmann, Thomas Brüning, Monika Raulf

First published: 30 January 2022

Abstract

Objective
Standardised quantitative analysis of the humoral immune response to SARS-CoV-2 antigens may be useful for estimating the extent and duration of immunity. The aim was to develop enzyme-linked immunosorbent assays (ELISAs) for the quantification of human IgG antibodies against... read more

Get in contact with us


By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.