PsiMP glycosidase

€790.00

Price excl. shipping costs excl. VAT. For more information, see our shipping policy

SKU: P2020-109 trenzyme

Need a quote for an individual request or for a bulk order?

Please contact us.

Description

The PsiMP glycosidase biologically has a cleavage function and catalyzes the reversible cleavage of the C-C glycoside bond to form ribose-5-phosphate and uracil. PsiMP glycosidase, together with the enzyme pseudouridine kinase, is responsible for the degradation of pseudouridine in E. coli.

Overview

  • Product Name: PsiMP glycosidase
  • Catalog No.: P2020-109
  • RefSeq Links: UniProt: P33025
  • Synonyms: Pseudouridine 5’-phosphate glycosidase; PsiMP glycosidase
Cellebrity Kolben Cell Cartoon trenzyme

Sequence Information

  • Species: Escherichia coli; Salmonella sp. HNK130
  • Tags: His-Tag, N-terminal
  • Sequence without tags (AA 1-312):
    MSELKISPELLQISPEVQDALKNKKPVVALESTIISHGMPF
    PQNAQTAIEVEETIRKQGAVPATIAIIGGVMKVGLSKEEIELLGREGHNVTKVSRRDLPF
    VVAAGKNGATTVASTMIIAALAGIKVFATGGIGGVHRGAEHTFDISADLQELANTNVTVV
    CAGAKSILDLGLTTEYLETFGVPLIGYQTKALPAFFCRTSPFDVSIRLDSASEIARAMVV
    KWQSGLNGGLVVANPIPEQFAMPEHTINAAIDQAVAEAEAQGVIGKESTPFLLARVAELT
    GGDSLKSNIQLVFNNAILASEIAKEYQRLAG

Product Information

  • Expression Host: E. coli
  • Formulation: PBS, pH  7,4
  • Format: Liquid, stored and shipped at -80°C
  • Purity: > 95% as determined by SDS-PAGE

Background Information

The enzymes PsiMP glycosidase and pseudouridine kinase are encoded by separate genes in bacterial genomes. PsiMP glycosidase is encoded by the yeiN gene, and pseudouridine kinase is encoded by the yeiC gene. Both genes belong to the same operon. In humans and other higher organisms, pseudouridine kinase and PsiMP glycosidase are not found. However, they are present in some eukaryotes as the only bifunctional enzymes.
In the process of pseudouridine degradation, when pseudouridine kinase phosphorylates pseudouridine, pseudouridine 5'-phosphate (PsiMP) is formed as a degradation product of RNAs. PsiMP is a non-classical nucleoside that has a glycosidic C-C bond and is present in human urine.


SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-PAGE of PsiMP glycosidase Histogram (of marked lane in gel picture) PsiMP glycosidase

Get in contact with us


By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.