Structural model of Spike S1 RBD

SARS-CoV-2 (COVID-19) Spike S1 Protein (RBD), liquid formulation

€300.00

Price excl. shipping costs excl. VAT. For more information, see our shipping policy

SKU: P2020-001 trenzyme

Contact us for a quote

Need a quote for an individual request or for a bulk order?

Please contact us.

Description

Recombinant protein of the receptor binding domain (RBD) of SARS-CoV-2 (COVID-19) Spike S1 from Wuhan pneumonia virus with C-terminal His-Tag, liquid formulation.

Overview

  • Product Name: SARS-CoV-2 (COVID-19) Spike S1 Protein (RBD), liquid formulation
  • Catalog No.: P2020-001
  • RefSeq Links: NC_045512.2; MN908947.3; YP_009724390.1; QHD43416.1; GeneID: 43740568; UniProt: P0DTC2
  • Synonyms: SARS-CoV-2; coronavirus; SARS-CoV-2 spike RBD; SARS-CoV-2 spike protein; 2019-nCoV; COVID-2019; COVID-19
Cellebrity Kolben Cell Cartoon trenzyme

Customer Testimonial

“In our COVID-19 projects, we have had very good experience with the SARS-CoV-2 proteins produced by trenzyme: rapid and reliable production of the functional proteins from different cell lines continued to provide first-class support for our projects.”


Dr. Peter Rauch
CANDOR Bioscience GmbH, Wangen, Germany

Sequence Information

  • Species: SARS-CoV-2; Wuhan seafood market pneumonia virus
  • Tags: His-Tag, C-terminal
  • Sequence without tags (AA 319-541):
    MRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTF
    KCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWN
    SNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGF
    QPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF

Product Information

  • Expression Host: human, HEK293
  • Formulation: PBS, pH 7,4
  • Format: Liquid, stored and shipped at -80 °C
  • Purity: > 85% as determined by SDS-PAGE

Background Information

The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The severe acute respiratory syndrome-coronavirus (SARS-CoV) spike (S) glycoprotein is responsible for membrane fusion and is therefore required for virus entry and cell fusion. The target protein is also a major immunogen and a possible target for entry inhibitors.
The SARS-CoV-2 spike (S) protein is a large type I transmembrane protein composed of two subunits, S1 and S2. The S1 subunit contains a receptor-binding domain (RBD) responsible for binding to the host cell receptor angiotensin-converting enzyme 2 (ACE2). The S2 subunit mediates fusion between the viral and host cell membranes. The S1 RBD protein plays key parts in the induction of neutralizing-antibody and T-cell responses, as well as protective immunity.


SARS-CoV-2 Spike S1 (RBD) recognizes hACE2 (ECD) with an affinity constant of 1 nM as verified by biolayer interferometry

SARS-CoV-2 Spike S1 (RBD) is highly pure and forms stable monomers of 28 kDa as verified by SEC
Biolayer interferometry binding analysis graph Determination of elution profile by absorbance at 289 nm (blue line).

Biolayer interferometry binding analysis (green lines) of hACE2 (ECD, processed), Tag-free to immobilized SARS-CoV-2 Spike S1 (RBD), His-Tag on Ni-NTA Dip and Read™ Biosensors. Grey lines correspond to a global fit of the data using a 1:1 binding model.
Device: Octet RED96e, ForteBio.

Size exclusion chromatography (SEC) of purified SARS-CoV-2 Spike S1 (RBD), His-Tag protein, determination of elution profile by absorbance at 280 nm (blue line).

 

Fluorescence chromatogram

Activity of SARS-CoV-2 S1(RBD)

Analysis of released N-glycans by HILIC (example data) of SARS-CoV-2 Spike S1 (RBD) Graphic showing activity of SARS-CoV-2 S1(RBD)

Analysis of released N-glycans by HILIC (example data). More and lot specific analytical data available on request (provided by our partner Biofidus AG).

Activity of different SARS-CoV-2 S1(RBD) lots was determined using a Sandwich-ELISA with antibodies from Sino Biological Europe GmbH (coat: #40150-D003 and detection: #40150-D001-H).

Stability during storage at 4°C
Stability during storage at 4°C determined by functional ELISA.

Stability during storage at 4°C determined by functional ELISA (binding to hACE2 (ECD) – Cat# P2020-016; detection by mAb CR3022).

 

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture
SDS-PAGE of SARS-CoV-2 Spike-S1 (RBD) Protein Histogram (of marked lane in gel picture) of SARS-CoV-2 Spike S1 Protein

Download

Download Product Information for SARS-CoV-2 Spike S1 Protein (RBD)

Citations


1 Ultra-sensitive and fast optical detection of the spike protein of the SARS-CoV-2 using AgNPs/SiNWs nanohybrid based sensors

Authors: Kais Daoudi, Krithikadevi Ramachandran, Hussain Alawadhi, Rabah Boukherroub, Elhadj Dogheche, et al.

First published: 15 September 2021

Abstract
Severe acute respiratory syndrome SARS-CoV-2 virus led to notable challenges amongst researchers in view of development of new and fast detecting techniques. In this regard, surface-enhanced Raman spectroscopy (SERS) technique, providing a fingerprint characteristic for each material, would be an interesting approach. The current study encompasses ... read more

2 Persistence of functional memory B cells recognizing SARS-CoV-2 variants despite loss of specific IgG

Authors: Stephan Winklmeier, Katharina Eisenhut, Damla Taskin, Heike Rübsamen, Ramona Gerhards, Celine Schneider, et al.

First published: 20 December 2021

Highlights
  • Memory B cells persist in blood of COVID-19 patients despite loss of specific Ig
  • Differentiating B cells in vitro robustly reveals previous SARS-CoV-2 infection
  • Ig derived from memory B cells neutralizes SARS-CoV-2 variants
  • Persisting memory B cells contribute to protective immunity against SARS-CoV-2
Summary
Although some COVID-19 patients maintain SARS-CoV-2-specific serum immunoglobulin G (IgG) for more than 6 months postinfection, others eventually lose IgG levels. We assessed the persistence of SARS-CoV-2-specific B cells in 17 patients, 5 of whom had lost specific IgGs after 5–8 months. Differentiation of blood-derived B cells ... read more

3 Continuous population-level monitoring of SARS-CoV-2 seroprevalence in a large European metropolitan region 

Authors: Marc Emmenegger, Elena De Cecco, David Lamparter, Raphaël P.B. Jacquat, Julien Riou, Dominik Menges et al.

First published: 17 February 2023

Highlights
  • We continuously assessed SARS-CoV-2 seroprevalence in two cohorts (n = 72′250)
  • Modeled cumulative incidence was 3 × higher than suggested by PCR-based testing
  • On the population level, antibody half-life was 75 days
  • 10% of individuals maintained symptoms one year post–COVID-19
Summary
Effective public health measures against SARS-CoV-2 require granular knowledge of population-level immune responses. We developed a Tripartite Automated Blood Immunoassay (TRABI) to assess the IgG response against three SARS-CoV-2 proteins. We used TRABI for continuous seromonitoring of hospital ... read more

4 Novel intranasal vaccine targeting SARS-CoV-2 receptor binding domain to mucosal microfold cells and adjuvanted with TLR3 agonist Riboxxim™ elicits strong antibody and T-cell responses in mice

Authors: Reinhold Horlacher, Armin Günther, Alexander Brosig, Jenny Morath, Barbara Jakobs, Marcus Groettrup, et al.

First published: March 2023

Abstract and Figures
SARS-CoV-2 continues to circulate in the human population necessitating regular booster immunization for its long-term control. Ideally, vaccines should ideally not only protect against symptomatic disease, but also prevent transmission via asymptomatic shedding and cover existing and future variants of the virus. This may ultimately only be possible through induction of potent and long-lasting immune... read more

Get in contact with us


By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.