human Interleukin-1 beta, tag-free
€310.00
Price excl. shipping costs excl. VAT. For more information, see our shipping policy
SKU: P2020-136 trenzyme
Description
Interleukin-1 beta (IL-1 beta) is a pivotal pro-inflammatory cytokine mediating innate and adaptive immune responses in response to infection or cell injury. Moreover, IL-1 beta is involved in a variety of autoimmune and inflammatory diseases caused by enhanced secretion of the cytokine. In further consequence, chronic inflammatory conditions promote tumor development and cancer malignancy.
Overview
-
Product Name: human Interleukin-1 beta, tag-free
-
Catalog No.: P2020-136
-
RefSeq Links: NP_000567.1; NM_000576.2; pdb1tp0 UniProt: P01584
-
Synonyms: IL-1 beta; Catabolin; IL-1B, IL-1 beta Protein; IL1-BETA Protein; IL1F2 Protein
Customer Testimonial
“We highly valued the fast and excellent communication and the high flexibility of the team! For any future project, we will preferably entrust in trenzyme’s protein production services.”
Dr. Thore Hettmann
Probiodrug AG, Halle/Saale, Germany
Sequence Information
- Species: Homo sapiens
- Tags: Tag-free; His-tag removed by proteolytic digest
-
Sequence without tags (AA 117-269):
MAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVA
LGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPN
WYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Product Information
- Expression Host: E. coli
- Formulation: PBS; pH 7.4
- Format: Liquid, stored and shipped at -80° C
- Purity: 95% as determined by SDS-PAGE
Background Information
The pro-inflammatory cytokine Interleukin-1 beta (IL-1 beta) is produced by a variety of cell types, including macrophages, dendritic cells, fibroblasts, endothelial cells and keratinocytes. Activation of IL-1 beta is tightly regulated as it is first produced as inactive precursor in response to infection or cell injury and has to be proteolytically cleaved by caspase-1, which is activated by a cytosolic pro-inflammatory signaling complex, the inflammasome. Proteolytic cleavage of pro-IL-1 beta results in secretion of mature IL-1 beta and induction of inflammatory responses by binding to the IL-1 type I receptor (IL-1RI). In particular, activation of IL-1 beta induces inflammation, fever, synthesis of acute phase proteins, as well as proliferation and differentiation of lymphocytes emphasizing its versatile biological functions. Activity is further regulated by several endogenous inhibitors including IL-1 type II receptor (IL-1RII) and IL-1 receptor antagonist (IL-1Ra). Dysregulation causes pathological conditions ranging from chronic inflammatory and autoinflammatory diseases to autoimmune syndromes, neurodegenerative diseases and cancer.
|
SDS-PAGE/Coll. Coomassie |
Histogram of marked lane in gel picture |
 |
 |
