greenTEV

€39.00

Price excl. shipping costs excl. VAT. For more information, see our shipping policy

SKU: P2020-142 trenzyme

Need a quote for an individual request or for a bulk order?

Please contact us.

Description

greenTEV is an optimized TEV protease (Tobacco Etch Virus Protease) fused to a GFP protein. greenTEV contains a His-Tag to facilitate the removal of the protease from the cleavage reaction after completion of cleavage. The removal of greenTEV can be monitored easily by following the fluorescence - this easy, fast and sensitive method omits time-consuming SDS-PAGE or Western blot analysis. The recognition sequence with the highest catalytic activity is ENLYFQ(G/S).

greenTEV is available in liquid or lyophilized form. The format and size can be selected by using the buttons.

If the green fluorescence of greenTEV is not suitable and you prefer blue fluorescence as readout, check our blueTEV protease.

If you want to test our product greenTEV, you can get a free sample using the code greenTEVFreeSample.

Simply choose the greenTEV variant P2020-142 lyophilized 200U, place it in your shopping card and enter the code during the logout process.

Overview

  • Product Name: greenTEV
  • Catalog No.: P2020-123 liquid, P2020-142 lyophilized 
  • RefSeq Links: UniProt: Q0GDU8
  • Synonyms: TEV Protease; TEV; Tobacco Etch Virus nuclear-inclusion-a endopeptidase; rTEV; P1 protease; EC 3.4.22.44

The optimized greenTEV protease and the Cleavage and tag control protein are also available together in the greenTEV Cleavage Kit - order it now!

Cellebrity Kolben Cell Cartoon trenzyme

Customer Testimonial

“We highly valued the fast and excellent communication and the high flexibility of the team! For any future project, we will preferably entrust in trenzyme’s protein production services.”


Dr. Thore Hettmann
Probiodrug AG, Halle/Saale, Germany

Sequence Information

  • Species: Tobaco Etch Virus
  • Tags: GFP, N-terminal and His-Tag, C-terminal
  • Sequence without tags (AA 5-236):
    KGPRDYNPISSSICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLVVQSLHGVFK
    VKDTTTLQQHLVDGRDMIIIRMPKDFPPFPQKLKFREPQREERICLVTTNFQTKSMSSMV
    SDTSCTFPSGDGIFWKHWIQTKDGQCGSPLVSTRDGFIVGIHSASNFTNTNNYFTSVPKN
    FMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMVKPEEPFQPVKEATQLMNE

Product Information

  • Expression Host: E. coli
  • Formulation: 
    Liquid:
     50 mM Tris, 150 mM NaCl, 0.5 mM EDTA, 40% Glycerol; pH 8.0
    Lyophilized: 50 mM Tris, 150 mM NaCl, 0.5 mM EDTA, 5% Trehalose; pH 8.0
  • Format: 
    Liquid: stored at -20 °C and shipped on blue ice
    Lyophilized: stored at -80 °C and shipped at ambient temperature.
    We recommend reconstituting the enzyme in 40 % Glycerol (w/v).
    In case of 0.2 kU, add 10 µl of 40 % Glycerol (w/v)
    In case of 1 kU, add 50 µl of 40 % Glycerol (w/v).
    In case of 10 kU, add 500 µl of 40 % Glycerol (w/v).
  • Purity: > 85% as determined by SDS-PAGE
  • Activity:
    ≥ 20 Units/µl (determined by cleavage of control protein)
    ≥ 0.25 µmol/min/mg (determined by cleavage of labeled peptide (Fluorometric assay), TEV Protease Activity Kit (Abcam))
  • Unit definition: One unit of greenTEV will cleave 3 µg of a fusion protein to 98 % in 1 hour at room temperature. It is recommended to optimize cleavage conditions for each fusion protein by varying the amount of greenTEV, reaction time, or temperature.

Background Information

greenTEV represents the catalytic domain of the nuclear inclusion a (NIa) protein with a molecular weight of 27 kDa encoded by the plant virus Tobacco Etch Virus. "green" indicates fusion of the protease to green fluorescent protein (GFP), which leads to increased stability and solubility of TEV protease. Moreover, greenTEV has been optimized by site directed mutagenesis to prevent autocatalytic cleavage. greenTEV is a highly site-specific cysteine protease that recognizes the amino acid sequence Glu-Asn-Leu-Tyr-Phe-Gln-(Gly/Ser) [ENLYFQ(G/S)] and cleaves between the residues Gln and Gly/Ser. The most commonly used recognition sequence is ENLYFQG. In biotechnology, greenTEV is a versatile enzyme to remove affinity tags from recombinant proteins with high specificity and activity over a wide range of pH, ionic strength and temperatures between 4 °C and 30 °C. The optimal temperature for cleavage is 30 °C. It is recommended to improve cleavage efficiency for each fusion protein by varying the amount of recombinant greenTEV, reaction time, or incubation temperature. The great advantage of greenTEV is its facile removal after cleavage reaction by immobilized metal affinity chromatography (IMAC) since it is equipped with a His-tag. Furthermore, the removal of greenTEV can be monitored instantly by detection of fluorescence in solution - this easy, fast and sensitive method omits time-consuming SDS-PAGE or Western blot analysis.
If the green fluorescence of greenTEV is not suitable and you prefer blue fluorescence as readout, check our blueTEV protease.

 

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-Page greenTEV
histogram greenTEV protease

 

Test Cleavage

Description of Test Cleavage

Test Cleavage greenTEV
Description of Test Cleavage greenTEV


Stability study of lyophilized TEV (blueTEV is shown as an example)

Stability study of lyophilized TEV

Description of Stability study

Stability study of lyophilized TEV
Description Stability study of lyophilized TEV

Get in contact with us


By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.