human BCMA
€370.00
Price excl. shipping costs excl. VAT. For more information, see our shipping policy
SKU: P2020-147 trenzyme
Description
B cell maturation antigen (BCMA) is a transmembrane glycoprotein that is predominantly expressed by mature B lymphocytes and mediates B cell survival. However, aberrant expression of BCMA contributes to malignant plasma cell survival promoting malignancy in cancer diseases, including leukemia, lymphomas, and most prominently multiple myeloma. Consequently, BCMA has emerged as a promising therapeutic target for the development of novel treatments for multiple myeloma.
Overview
-
Product Name: human BCMA
-
Catalog No.: P2020-147 GFP/His-Tag; P2020-148 FC/His-Tag
-
RefSeq Links: UniProt: Q02223 HGNC:11913; NX_Q02223; NP_001183.2; NP_001183.2NM_001192.2; PDBe 8hxq
-
Synonyms: TNFRSF17, Tumor necrosis factor receptor superfamily member 17, CD269, CD antigen CD269, BCM, BCMA, B-cell maturation protein
Customer Testimonial
“We highly valued the fast and excellent communication and the high flexibility of the team! For any future project, we will preferably entrust in trenzyme’s protein production services.”
Dr. Thore Hettmann
Probiodrug AG, Halle/Saale, Germany
Sequence Information
- Species: Homo sapiens
-
Tags:
P2020-147: GFP/His-tag, C-terminal
P2020-148: Fc/His-tag, C-terminal -
Sequence without tags (AA 1-54):
MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA
Product Information
-
Expression Host: HEK293
-
Formulation: PBS; pH 7.4
- Format: Liquid, stored and shipped at -80° C
-
Purity: > 95 % as determined by SDS-PAGE
- Application: ELISA, WB, Immunostaining, Functional assay
Background Information
B cell maturation antigen (BCMA), also known as tumor necrosis factor receptor superfamily member 17 (TNFRSF17), is a transmembrane glycoprotein crucial for the survival and function of B lymphocytes, particularly plasma cells. Signaling via BCMA is induced by binding to its ligands, a B cell activating factor (BAFF) and a proliferation-inducing ligand (APRIL), both of which are essential for B cell survival, maturation, and differentiation. BCMA has gained significant attention in the context of hematologic malignancies, particularly multiple myeloma. Aberrant expression of BCMA on myeloma cells contributes to the survival and proliferation of these malignant plasma cells. Therefore, a variety of therapeutic approaches targeting BCMA, such as bispecific antibody constructs, antibody-drug conjugates (ADCs), and chimeric antigen receptor (CAR)-modified T cell therapy, have been developed and revealed promising results in preclinical and clinical studies. Despite the progress in BCMA-targeted therapies, challenges regarding resistance mechanisms and relapse need to be further addressed.
Additional information BCMA, GFP/His-Tag
|
SDS-PAGE/Coll. Coomassie |
Histogram of marked lane in gel picture |
 |
 |
Additional information BCMA, FC/His-Tag
|
SDS-PAGE/Coll. Coomassie |
Histogram of marked lane in gel picture |
 |
 |
