greenTEV
€99.00
Price excl. shipping costs excl. VAT. For more information, see our shipping policy
SKU: P2020-123 trenzyme
Description
greenTEV is an optimized TEV protease (Tobacco Etch Virus Protease) fused to a GFP protein. greenTEV contains an His-Tag to facilitate the removal of the protease from the cleavage reaction after completion of cleavage. The removal of greenTEV can be monitored easily by following the fluorescence. The recognition sequence with the highest catalytic activity is ENLYFQ(G/S).
Overview
-
Product Name: greenTEV
- Catalog No.: P2020-123
- RefSeq Links: UniProt: Q0GDU8
- Synonyms: TEV Protease; TEV; Tobacco Etch Virus nuclear-inclusion-a endopeptidase; rTEV; P1 protease; EC 3.4.22.44
Customer Testimonial
“We highly valued the fast and excellent communication and the high flexibility of the team! For any future project, we will preferably entrust in trenzyme’s protein production services.”
Dr. Thore Hettmann
Probiodrug AG, Halle/Saale, Germany
Sequence Information
- Species: Tobaco Etch Virus
- Tags: GFP, N-terminal and His-Tag, C-terminal
-
Sequence without tags (AA 5-236):
KGPRDYNPISSSICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLVVQSLHGVFK
VKDTTTLQQHLVDGRDMIIIRMPKDFPPFPQKLKFREPQREERICLVTTNFQTKSMSSMV
SDTSCTFPSGDGIFWKHWIQTKDGQCGSPLVSTRDGFIVGIHSASNFTNTNNYFTSVPKN
FMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMVKPEEPFQPVKEATQLMNE
Product Information
- Expression Host: E. coli
- Formulation: 50 mM Tris, 150 mM NaCl, 0.5 mM EDTA, 40% Glycerol; pH 8.0
-
Format: Liquid, stored at -20 °C and shipped on blue ice
- Purity: > 85% as determined by SDS-PAGE
- Activity: > 0.25 µmol/min/mg (determined by cleavage of labeled peptide (Fluorometric assay), TEV Protease Activity Kit (Abcam))
Background Information
greenTEV is an high specific cystein protease (TEV protease, Tobacco Etch Virus Protease) fused to a GFP protein. greenTEV is a highly site-specific cysteine protease optimized for cleavage of tags from fusion proteins containing a TEV-site. The optimal temperature for cleavage is 30°C; also it can be used at temperature as low as 4°C. It is recommended that the cleavage for each fusion protein be optimized by varying the amount of recombinant greenTEV protease, reaction time, or incubation temperature. Since the greenTEV contains an His-Tag, it can easily be removed by Ni2+ affinity resin. The optimum recognition site for this enzyme is the sequence Glu-Asn-Leu-Tyr-Phe-Gln-(Gly/Ser) [ENLYFQ(G/S)] and cleavage occurs between the Gln and Gly/Ser residues. The most commonly used sequence is ENLYFQG.
|
SDS-PAGE/Coll. Coomassie |
Histogram of marked lane in gel picture |
 |
 |