greenTEV

• Species: Tobaco Etch Virus
• Tags: GFP, N-terminal and His-Tag, C-terminal
• Sequence without tags (AA 5-236):
  KGPRDYNPISSSICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLVVQSLHGVFK
  VKDTTTLQQHLVDGRDMIIIRMPKDFPPFPQKLKFREPQREERICLVTTNFQTKSMSSMV
  SDTSCTFPSGDGIFWKHWIQTKDGQCGSPLVSTRDGFIVGIHSASNFTNTNNYFTSVPKN
  FMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMVKPEEPFQPVKEATQLMNE
  
  

• Expression Host: E. coli
• Formulation: 50 mM Tris, 150 mM NaCl, 0.5 mM EDTA, 40% Glycerol; pH 8.0
• Format: Liquid, stored at -20 °C and shipped on blue ice
  
• Purity: > 85% as determined by SDS-PAGE
• Activity: > 0.25 µmol/min/mg (determined by cleavage of Fluorescein-based peptide, TEV Protease Activity Kit (Abcam))

greenTEV is an high specific cystein protease (TEV protease, Tobacco Etch Virus Protease) fused to a GFP protein. greenTEV is a highly site-specific cysteine protease optimized for cleavage of tags from fusion proteins containing a TEV-site. The optimal temperature for cleavage is 30°C; also it can be used at temperature as low as 4°C. It is recommended that the cleavage for each fusion protein be optimized by varying the amount of recombinant greenTEV protease, reaction time, or incubation temperature. Since the greenTEV contains an His-Tag, it can easily be removed by Ni2+ affinity resin. The optimum recognition site for this enzyme is the sequence Glu-Asn-Leu-Tyr-Phe-Gln-(Gly/Ser) [ENLYFQ(G/S)] and cleavage occurs between the Gln and Gly/Ser residues. The most commonly used sequence is ENLYFQG.

SDS-PAGE/Coll. Coomassie	Histogram of marked lane in gel picture

Download Product Information for greenTEV