greenTEV

€99.00

Price excl. shipping costs excl. VAT. For more information, see our shipping policy

SKU: P2020-123 trenzyme

Need a quote for an individual request or for a bulk order?

Please contact us.

Description

greenTEV is an optimized TEV protease (Tobacco Etch Virus Protease) fused to a GFP protein. greenTEV contains an His-Tag to facilitate the removal of the protease from the cleavage reaction after completion of cleavage. The removal of greenTEV can be monitored easily by following the fluorescence. The recognition sequence with the highest catalytic activity is ENLYFQ(G/S).

Overview

  • Product Name: greenTEV
  • Catalog No.: P2020-123
  • RefSeq Links: UniProt: Q0GDU8
  • Synonyms: TEV Protease; TEV; Tobacco Etch Virus nuclear-inclusion-a endopeptidase; rTEV; P1 protease; EC 3.4.22.44
Cellebrity Kolben Cell Cartoon trenzyme

Customer Testimonial

“We highly valued the fast and excellent communication and the high flexibility of the team! For any future project, we will preferably entrust in trenzyme’s protein production services.”


Dr. Thore Hettmann
Probiodrug AG, Halle/Saale, Germany

Sequence Information

  • Species: Tobaco Etch Virus
  • Tags: GFP, N-terminal and His-Tag, C-terminal
  • Sequence without tags (AA 5-236):
    KGPRDYNPISSSICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLVVQSLHGVFK
    VKDTTTLQQHLVDGRDMIIIRMPKDFPPFPQKLKFREPQREERICLVTTNFQTKSMSSMV
    SDTSCTFPSGDGIFWKHWIQTKDGQCGSPLVSTRDGFIVGIHSASNFTNTNNYFTSVPKN
    FMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMVKPEEPFQPVKEATQLMNE

Product Information

  • Expression Host: E. coli
  • Formulation: 50 mM Tris, 150 mM NaCl, 0.5 mM EDTA, 40% Glycerol; pH 8.0
  • Format: Liquid, stored at -20 °C and shipped on blue ice
  • Purity: > 85% as determined by SDS-PAGE
  • Activity: > 0.25 µmol/min/mg (determined by cleavage of labeled peptide (Fluorometric assay), TEV Protease Activity Kit (Abcam))
    0.5 - 1 u/µg (determined by cleavage of control protein)
  • Unit definition: One unit of greenTEV will cleave 60 µg of a fusion protein to 98 % in 24 hours at room temperature. It is recommended to optimize cleavage conditions for each fusion protein by varying the amount of greenTEV, reaction time, or temperature

Background Information

greenTEV is an high specific cystein protease (TEV protease, Tobacco Etch Virus Protease) fused to a GFP protein. greenTEV is a highly site-specific cysteine protease optimized for cleavage of tags from fusion proteins containing a TEV-site. The optimal temperature for cleavage is 30°C; also it can be used at temperature as low as 4°C. It is recommended that the cleavage for each fusion protein be optimized by varying the amount of recombinant greenTEV protease, reaction time, or incubation temperature. Since the greenTEV contains an His-Tag, it can easily be removed by Ni2+ affinity resin. The optimum recognition site for this enzyme is the sequence Glu-Asn-Leu-Tyr-Phe-Gln-(Gly/Ser) [ENLYFQ(G/S)] and cleavage occurs between the Gln and Gly/Ser residues. The most commonly used sequence is ENLYFQG.


SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-PAGE of greenTEV Histogram (of marked lane in gel picture) greenTEV

Test Cleavage

Description of Test Cleavage

Test Cleavage Description of Test Cleavage

Get in contact with us


By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.