hACE2 Protein (ECD, processed), Tag-free, lyophilized formulation

€2,590.00

Price excl. shipping costs excl. VAT. For more information, see our shipping policy

SKU: P2020-024 trenzyme

Need a quote for an individual request or for a bulk order?

Please contact us.

Description

The human Angiotensin-Converting Enzyme 2 (hACE2) is a protein highly expressed at the surface of cells of the human lungs, arteries, kidney, heart and intestine and is shown to be the entry receptor for SARS-CoV-2 infection. The hACE2 protein is one of the most important components for Coronavirus research to develop effective therapies for COVID-19.

Overview

  • Product Name: hACE2 Protein (ECD, processed), Tag-free, lyophilized formulation
  • Catalog No.: P2020-024
  • RefSeq Links: UniProt: Q9BYF1
  • Synonyms: hACE2; ACEH; human angiotensin-converting enzyme 2; ACE-related carboxypeptidase; Angiotensin-converting enzyme homolog; Metalloprotease MPROT15
Cellebrity Kolben Cell Cartoon trenzyme

Sequence Information

  • Species: Homo sapiens, human
  • Tags: Tag-free
  • Sequence without tags (AA 20-708):
    MTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQST
    LAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNP
    QECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYED
    YGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISP
    IGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQAWDAQRIFKEAEKFFVSV
    GLPNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDFRILMCTKVTMDDFLTAHHEMGH
    IQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINF
    LLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYC
    DPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNML
    RLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYADQSI
    KVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQMILFGEEDVRVANLKPR
    ISFNFFVTAPKNVSDIIPRTEVEKAIRMSR

Product Information

  • Expression Host: human, HEK293
  • Formulation: 50 mM Tris, 250 mM NaCl, pH 8,0
  • Format: Lyophilized and shipped at room temperature.
  • Purity: > 80% as determined by SDS-PAGE

If maximum activity is needed, we recommend ordering our protein as liquid formulation: P2020-016 hACE2 Protein (ECD, processed), Tag-free, liquid

Background Information

The human Angiotensin-Converting Enzyme 2 (hACE2) is a type I transmembrane metallocarboxypeptidase with homology to ACE, a regulator in the Renin-Angiotensin system (RAS) and long-known as a target for the treatment of hypertension.

hACE2 is expressed at the surface of cells of the human lungs, arteries, kidneys, heart and intestine – all tissues shown to harbor SARS-CoV. The function of ACE2 is known as controlling blood pressure. This is accomplished by the hydrolysis of a small peptide hormone called Angiotensin II into the nonapeptide Angiotensin 1-9, which is thereafter converted into the heptapeptide angiotensin 1-7 by ACE and other endopeptidases. Angiotensin 1-7 acts in a vasoconstricting manner and is believed to be one of the main effectors in controlling the blood pressure and is therefore involved in pathophysiological processes like diabetes, hypertension and cardiac function in general. Recently it became known, that the new Coronavirus SARS-CoV-2 uses ACE2 as the entry point into alveolar cells of the lungs, where it replicates and causes the Coronavirus disease (COVID-19).​

Get in contact with us


By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.