hACE2 Protein (ECD, processed), Tag-free, liquid formulation
€590.00
Price excl. shipping costs excl. VAT. For more information, see our shipping policy
SKU: P2020-016 trenzyme
Description
The human Angiotensin-Converting Enzyme 2 (hACE2) is a protein highly expressed at the surface of cells of the human lungs, arteries, kidney, heart and intestine and is shown to be the entry receptor for SARS-CoV-2 infection. The hACE2 protein is one of the most important components for Coronavirus research to develop effective therapies for COVID-19. Our recombinant human ACE2 protein (ECD, processed) and tag-free has high quality and is excellent for SARS-CoV2 R&D.
Overview
- Product Name: hACE2 Protein (ECD, processed), Tag-free, liquid formulation
- Catalog No.: P2020-016
- RefSeq Links: UniProt: Q9BYF1
- Synonyms: hACE2; ACEH; human angiotensin-converting enzyme 2; ACE-related carboxypeptidase; Angiotensin-converting enzyme homolog; Metalloprotease MPROT15
Sequence Information
- Species: Homo sapiens, human
- Tags: Tag-free
-
Sequence without tags (AA 20-708):
MTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQST
LAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNP
QECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYED
YGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISP
IGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQAWDAQRIFKEAEKFFVSV
GLPNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDFRILMCTKVTMDDFLTAHHEMGH
IQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINF
LLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYC
DPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNML
RLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYADQSI
KVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQMILFGEEDVRVANLKPR
ISFNFFVTAPKNVSDIIPRTEVEKAIRMSR
Product Information
- Expression Host: human, HEK293
- Formulation: 50 mM Tris, 250 mM NaCl, pH 8,0
- Format: Liquid, stored and shipped at -80°C
- Purity: > 80% as determined by SDS-PAGE
Background Information
The human Angiotensin-Converting Enzyme 2 (hACE2) is a type I transmembrane metallocarboxypeptidase with homology to ACE, an regulator in the Renin-Angiotensin system (RAS) and long-known as a target for the treatment of hypertension.
hACE2 is expressed at the surface of cells of the human lungs, arteries, kidneys, heart and intestine – all tissues shown to harbor SARS-CoV. The function of ACE2 is known as controlling blood pressure. This is accomplished by the hydrolysis of a small peptide hormone called Angiotensin II into the nonapeptide Angiotensin 1-9, which is thereafter converted into the heptapeptide angiotensin 1-7 by ACE and other endopeptidases. Angiotensin 1-7 acts in a vasoconstricting manner and is believed to be one of the main effectors in controlling the blood pressure and is therefore involved in pathophysiological processes like diabetes, hypertension and cardiac function in general. Recently it became known, that the new Coronavirus SARS-CoV-2 uses ACE2 as the entry point into alveolar cells of the lungs, where it replicates and causes the Coronavirus disease (COVID-19).
|
SARS-CoV-2 Spike S1 (RBD) recognizes hACE2 (ECD) with an affinity constant of 1 nM as verified by biolayer interferometry |
Size exclusion chromotography (SEC)
|
 |
 |
|
Biolayer interferometry binding analysis (green lines) of hACE2 (ECD, processed), Tag-free to immobilized SARS-CoV-2 Spike S1 (RBD), His-Tag on Ni-NTA Dip and Read™ Biosensors. Grey lines correspond to a global fit of the data using a 1:1 binding model. |
Analytical size exclusion chromotography (SEC) of the purified protein indicates an at least dimeric running behavior (blue arrow).
|
|
Fluorescence chromatogram |
|
 |
|
|
Analysis of released N-glycans by HILIC (example data). More and lot specific analytical data available on request (provided by our partner Biofidus AG). |
|
|
SDS-PAGE/Coll. Coomassie |
Histogram of marked lane in gel picture |
 |
 |
Download
Related to the hACE2 Protein (ECD, processed), Tag-free, liquid formulation
